Lineage for d1qlda_ (1qld A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1964568Fold g.29: Type X cellulose binding domain, CBDX [57614] (1 superfamily)
    disulfide-rich, alpha+beta
  4. 1964569Superfamily g.29.1: Type X cellulose binding domain, CBDX [57615] (1 family) (S)
  5. 1964570Family g.29.1.1: Type X cellulose binding domain, CBDX [57616] (1 protein)
  6. 1964571Protein Endo-1;4-beta-xylanase A CBDX [57617] (1 species)
  7. 1964572Species Pseudomonas fluorescens, subsp. cellulosa [TaxId:294] [57618] (2 PDB entries)
  8. 1964573Domain d1qlda_: 1qld A: [44961]

Details for d1qlda_

PDB Entry: 1qld (more details)

PDB Description: solution structure of type x cbm
PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d1qlda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlda_ g.29.1.1 (A:) Endo-1;4-beta-xylanase A CBDX {Pseudomonas fluorescens, subsp. cellulosa [TaxId: 294]}
mgnqqcnwygtlyplcvtttngwgwedqrsciarstcaaqpapfgivgsg

SCOPe Domain Coordinates for d1qlda_:

Click to download the PDB-style file with coordinates for d1qlda_.
(The format of our PDB-style files is described here.)

Timeline for d1qlda_: