Lineage for d1qlda_ (1qld A:)
- Root: SCOP 1.57
Class g: Small proteins [56992] (56 folds) 
Fold g.29: Type X cellulose binding domain, CBDX [57614] (1 superfamily) Superfamily g.29.1: Type X cellulose binding domain, CBDX [57615] (1 family) 
Family g.29.1.1: Type X cellulose binding domain, CBDX [57616] (1 protein) Protein Endo-1;4-beta-xylanase A CBDX [57617] (1 species) Species Pseudomonas fluorescens, subsp. cellulosa [TaxId:294] [57618] (2 PDB entries) 
Domain d1qlda_: 1qld A: [44961]
Details for d1qlda_
PDB Entry: 1qld (more details)
PDB Description: solution structure of type x cbm
SCOP Domain Sequences for d1qlda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qlda_ g.29.1.1 (A:) Endo-1;4-beta-xylanase A CBDX {Pseudomonas fluorescens, subsp. cellulosa}
mgnqqcnwygtlyplcvtttngwgwedqrsciarstcaaqpapfgivgsg
SCOP Domain Coordinates for d1qlda_:
Click to download the PDB-style file with coordinates for d1qlda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qlda_:
- d1qlda_ first appeared (with stable ids) in SCOP 1.55
- d1qlda_ appears in SCOP 1.59
- d1qlda_ appears in the current release, SCOPe 2.08, called d1qlda1
View in 3D