![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.28: Thyroglobulin type-1 domain [57609] (1 superfamily) disulfide-rich, alpha+beta |
![]() | Superfamily g.28.1: Thyroglobulin type-1 domain [57610] (1 family) ![]() |
![]() | Family g.28.1.1: Thyroglobulin type-1 domain [57611] (5 proteins) Pfam PF00086 |
![]() | Protein Class II MHC associated p41 invariant chain fragment [57612] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57613] (2 PDB entries) |
![]() | Domain d1icfj_: 1icf J: [44959] Other proteins in same PDB: d1icf.1, d1icf.2 complexed with nag |
PDB Entry: 1icf (more details), 2 Å
SCOPe Domain Sequences for d1icfj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1icfj_ g.28.1.1 (J:) Class II MHC associated p41 invariant chain fragment {Human (Homo sapiens) [TaxId: 9606]} ltkcqeevshipavhpgsfrpkcdengnylplqcygsigycwcvfpngtevpntrsrghh ncses
Timeline for d1icfj_: