SCOP 1.71: Domain d1icfj_: 1icf J:

Lineage for d1icfj_ (1icf J:)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.28: Thyroglobulin type-1 domain [57609] (1 superfamily)
   disulfide-rich, alpha+beta

4. Superfamily g.28.1: Thyroglobulin type-1 domain [57610] (1 family)

5. Family g.28.1.1: Thyroglobulin type-1 domain [57611] (2 proteins)
   Pfam 00086

6. Protein Class II MHC associated p41 invariant chain fragment [57612] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57613] (2 PDB entries)

8. Domain d1icfj_: 1icf J: [44959]
   Other proteins in same PDB: d1icf.1, d1icf.2

Details for d1icfj_

PDB Entry: 1icf, 2 Å

PDB Description: crystal structure of mhc class ii associated p41 ii fragment in complex with cathepsin l

SCOP Domain Sequences for d1icfj_:

Sequence; same for both SEQRES and ATOM records:

>d1icfj_ g.28.1.1 (J:) Class II MHC associated p41 invariant chain fragment {Human (Homo sapiens)}
ltkcqeevshipavhpgsfrpkcdengnylplqcygsigycwcvfpngtevpntrsrghh
ncses

Timeline for d1icfj_:

• d1icfj_ first appeared (with stable ids) in SCOP 1.55
  
• d1icfj_ appears in SCOP 1.69
  
• d1icfj_ appears in SCOP 1.73
  
• d1icfj_ appears in the current release, SCOPe 2.08