SCOPe 2.07: Domain d1icfi_: 1icf I:

Lineage for d1icfi_ (1icf I:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.28: Thyroglobulin type-1 domain [57609] (1 superfamily)
   disulfide-rich, alpha+beta

4. Superfamily g.28.1: Thyroglobulin type-1 domain [57610] (2 families)

5. Family g.28.1.1: Thyroglobulin type-1 domain [57611] (5 proteins)
   Pfam PF00086

6. Protein Class II MHC associated p41 invariant chain fragment [57612] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57613] (2 PDB entries)

8. Domain d1icfi_: 1icf I: [44958]
   Other proteins in same PDB: d1icf.1, d1icf.2
   complexed with nag

Details for d1icfi_

PDB Entry: 1icf, 2 Å

PDB Description: crystal structure of mhc class ii associated p41 ii fragment in complex with cathepsin l

PDB Compounds: (I:) protein (invariant chain)

SCOPe Domain Sequences for d1icfi_:

Sequence; same for both SEQRES and ATOM records:

>d1icfi_ g.28.1.1 (I:) Class II MHC associated p41 invariant chain fragment {Human (Homo sapiens) [TaxId: 9606]}
ltkcqeevshipavhpgsfrpkcdengnylplqcygsigycwcvfpngtevpntrsrghh
ncses

Timeline for d1icfi_:

• d1icfi_ first appeared (with stable ids) in SCOP 1.55
  
• d1icfi_ appears in SCOPe 2.06
  
• d1icfi_ appears in the current release, SCOPe 2.08