Lineage for d1icfi_ (1icf I:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 891925Fold g.28: Thyroglobulin type-1 domain [57609] (1 superfamily)
    disulfide-rich, alpha+beta
  4. 891926Superfamily g.28.1: Thyroglobulin type-1 domain [57610] (1 family) (S)
  5. 891927Family g.28.1.1: Thyroglobulin type-1 domain [57611] (4 proteins)
    Pfam PF00086
  6. 891928Protein Class II MHC associated p41 invariant chain fragment [57612] (1 species)
  7. 891929Species Human (Homo sapiens) [TaxId:9606] [57613] (2 PDB entries)
  8. 891930Domain d1icfi_: 1icf I: [44958]
    Other proteins in same PDB: d1icf.1, d1icf.2

Details for d1icfi_

PDB Entry: 1icf (more details), 2 Å

PDB Description: crystal structure of mhc class ii associated p41 ii fragment in complex with cathepsin l
PDB Compounds: (I:) protein (invariant chain)

SCOP Domain Sequences for d1icfi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1icfi_ g.28.1.1 (I:) Class II MHC associated p41 invariant chain fragment {Human (Homo sapiens) [TaxId: 9606]}
ltkcqeevshipavhpgsfrpkcdengnylplqcygsigycwcvfpngtevpntrsrghh
ncses

SCOP Domain Coordinates for d1icfi_:

Click to download the PDB-style file with coordinates for d1icfi_.
(The format of our PDB-style files is described here.)

Timeline for d1icfi_: