SCOPe 2.05: Domain d1tpma_: 1tpm A:

Lineage for d1tpma_ (1tpm A:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.27: FnI-like domain [57602] (1 superfamily)
   disulfide-rich, all-beta

4. Superfamily g.27.1: FnI-like domain [57603] (3 families)

5. Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
   automatically mapped to Pfam PF00039

6. Protein Tissue-type plasminogen activator, t-PA [57607] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57608] (3 PDB entries)

8. Domain d1tpma_: 1tpm A: [44957]

Details for d1tpma_

PDB Entry: 1tpm

PDB Description: solution structure of the fibrin binding finger domain of tissue-type plasminogen activator determined by 1h nuclear magnetic resonance

PDB Compounds: (A:) tissue-type plasminogen activator

SCOPe Domain Sequences for d1tpma_:

Sequence; same for both SEQRES and ATOM records:

>d1tpma_ g.27.1.1 (A:) Tissue-type plasminogen activator, t-PA {Human (Homo sapiens) [TaxId: 9606]}
syqvicrdektqmiyqqhqswlrpvlrsnrveycwcnsgraqchsvpvks

Timeline for d1tpma_:

• d1tpma_ first appeared (with stable ids) in SCOP 1.55, called d1tpm__
  
• d1tpma_ appears in SCOPe 2.04
  
• d1tpma_ appears in SCOPe 2.06
  
• d1tpma_ appears in the current release, SCOPe 2.08