SCOP 1.63: Domain d1tpm__: 1tpm -

Lineage for d1tpm__ (1tpm -)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.27: Fibronectin type I module [57602] (1 superfamily)
   disulphide-rich, all-beta

4. Superfamily g.27.1: Fibronectin type I module [57603] (1 family)

5. Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)

6. Protein Tissue-type plasminogen activator, t-PA [57607] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57608] (3 PDB entries)

8. Domain d1tpm__: 1tpm - [44957]

Details for d1tpm__

PDB Entry: 1tpm

PDB Description: solution structure of the fibrin binding finger domain of tissue-type plasminogen activator determined by 1h nuclear magnetic resonance

SCOP Domain Sequences for d1tpm__:

Sequence; same for both SEQRES and ATOM records:

>d1tpm__ g.27.1.1 (-) Tissue-type plasminogen activator, t-PA {Human (Homo sapiens)}
syqvicrdektqmiyqqhqswlrpvlrsnrveycwcnsgraqchsvpvks

Timeline for d1tpm__:

• d1tpm__ first appeared (with stable ids) in SCOP 1.55
  
• d1tpm__ appears in SCOP 1.61
  
• d1tpm__ appears in SCOP 1.65
  
• d1tpm__ appears in the current release, SCOPe 2.08, called d1tpma_