SCOPe 2.05: Domain d1tpga2: 1tpg A:1-50

Lineage for d1tpga2 (1tpg A:1-50)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.27: FnI-like domain [57602] (1 superfamily)
   disulfide-rich, all-beta

4. Superfamily g.27.1: FnI-like domain [57603] (3 families)

5. Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
   automatically mapped to Pfam PF00039

6. Protein Tissue-type plasminogen activator, t-PA [57607] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57608] (3 PDB entries)

8. Domain d1tpga2: 1tpg A:1-50 [44955]
   Other proteins in same PDB: d1tpga1

Details for d1tpga2

PDB Entry: 1tpg

PDB Description: f1-g module pair residues 1-91 (c83s) of tissue-type plasminogen activator (t-pa) (nmr, 298k, ph2.95, representative structure)

PDB Compounds: (A:) t-plasminogen activator f1-g

SCOPe Domain Sequences for d1tpga2:

Sequence; same for both SEQRES and ATOM records:

>d1tpga2 g.27.1.1 (A:1-50) Tissue-type plasminogen activator, t-PA {Human (Homo sapiens) [TaxId: 9606]}
syqvicrdektqmiyqqhqswlrpvlrsnrveycwcnsgraqchsvpvks

Timeline for d1tpga2:

• d1tpga2 first appeared (with stable ids) in SCOP 1.55, called d1tpg_2
  
• d1tpga2 appears in SCOPe 2.04
  
• d1tpga2 appears in SCOPe 2.06
  
• d1tpga2 appears in the current release, SCOPe 2.08