Lineage for d1tpga2 (1tpg A:1-50)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1243609Fold g.27: FnI-like domain [57602] (1 superfamily)
    disulfide-rich, all-beta
  4. 1243610Superfamily g.27.1: FnI-like domain [57603] (2 families) (S)
  5. 1243611Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
  6. 1243661Protein Tissue-type plasminogen activator, t-PA [57607] (1 species)
  7. 1243662Species Human (Homo sapiens) [TaxId:9606] [57608] (3 PDB entries)
  8. 1243665Domain d1tpga2: 1tpg A:1-50 [44955]
    Other proteins in same PDB: d1tpga1

Details for d1tpga2

PDB Entry: 1tpg (more details)

PDB Description: f1-g module pair residues 1-91 (c83s) of tissue-type plasminogen activator (t-pa) (nmr, 298k, ph2.95, representative structure)
PDB Compounds: (A:) t-plasminogen activator f1-g

SCOPe Domain Sequences for d1tpga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tpga2 g.27.1.1 (A:1-50) Tissue-type plasminogen activator, t-PA {Human (Homo sapiens) [TaxId: 9606]}
syqvicrdektqmiyqqhqswlrpvlrsnrveycwcnsgraqchsvpvks

SCOPe Domain Coordinates for d1tpga2:

Click to download the PDB-style file with coordinates for d1tpga2.
(The format of our PDB-style files is described here.)

Timeline for d1tpga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tpga1