SCOP 1.71: Domain d1tpg_2: 1tpg 1-50

Lineage for d1tpg_2 (1tpg 1-50)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.27: FnI-like domain [57602] (1 superfamily)
   disulfide-rich, all-beta

4. Superfamily g.27.1: FnI-like domain [57603] (2 families)

5. Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)

6. Protein Tissue-type plasminogen activator, t-PA [57607] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57608] (3 PDB entries)

8. Domain d1tpg_2: 1tpg 1-50 [44955]
   Other proteins in same PDB: d1tpg_1
   mutant

Details for d1tpg_2

PDB Entry: 1tpg

PDB Description: f1-g module pair residues 1-91 (c83s) of tissue-type plasminogen activator (t-pa) (nmr, 298k, ph2.95, representative structure)

SCOP Domain Sequences for d1tpg_2:

Sequence; same for both SEQRES and ATOM records:

>d1tpg_2 g.27.1.1 (1-50) Tissue-type plasminogen activator, t-PA {Human (Homo sapiens)}
syqvicrdektqmiyqqhqswlrpvlrsnrveycwcnsgraqchsvpvks

Timeline for d1tpg_2:

• d1tpg_2 first appeared (with stable ids) in SCOP 1.55
  
• d1tpg_2 appears in SCOP 1.69
  
• d1tpg_2 is called d1tpga2 in SCOP 1.73
  
• d1tpg_2 appears in the current release, SCOPe 2.08, called d1tpga2