Lineage for d1qo6a2 (1qo6 A:1-41)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1462729Fold g.27: FnI-like domain [57602] (1 superfamily)
    disulfide-rich, all-beta
  4. 1462730Superfamily g.27.1: FnI-like domain [57603] (2 families) (S)
  5. 1462731Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
    automatically mapped to Pfam PF00039
  6. 1462732Protein Fibronectin [57605] (1 species)
  7. 1462733Species Human (Homo sapiens) [TaxId:9606] [57606] (13 PDB entries)
  8. 1462780Domain d1qo6a2: 1qo6 A:1-41 [44954]
    Other proteins in same PDB: d1qo6a1
    part of the gelatin-binding domain

Details for d1qo6a2

PDB Entry: 1qo6 (more details)

PDB Description: solution structure of a pair of modules from the gelatin-binding domain of fibronectin
PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d1qo6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo6a2 g.27.1.1 (A:1-41) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
yghcvtdsgvvysvgmqwlktqgnkqmlctclgngvscqet

SCOPe Domain Coordinates for d1qo6a2:

Click to download the PDB-style file with coordinates for d1qo6a2.
(The format of our PDB-style files is described here.)

Timeline for d1qo6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qo6a1