SCOP 1.67: Domain d1qgba2: 1qgb A:61-109

Lineage for d1qgba2 (1qgb A:61-109)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.27: Fibronectin type I module [57602] (1 superfamily)
   disulfide-rich, all-beta

4. Superfamily g.27.1: Fibronectin type I module [57603] (1 family)

5. Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)

6. Protein Fibronectin [57605] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57606] (6 PDB entries)

8. Domain d1qgba2: 1qgb A:61-109 [44953]
   1st and 2nd modules

Details for d1qgba2

PDB Entry: 1qgb

PDB Description: solution structure of the n-terminal f1 module pair from human fibronectin

SCOP Domain Sequences for d1qgba2:

Sequence; same for both SEQRES and ATOM records:

>d1qgba2 g.27.1.1 (A:61-109) Fibronectin {Human (Homo sapiens)}
eaeetcfdkytgntyrvgdtyerpkdsmiwdctcigagrgrisctianr

Timeline for d1qgba2:

• d1qgba2 first appeared (with stable ids) in SCOP 1.55
  
• d1qgba2 appears in SCOP 1.65
  
• d1qgba2 appears in SCOP 1.69
  
• d1qgba2 appears in the current release, SCOPe 2.08