Lineage for d1qgba1 (1qgb A:17-60)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1243609Fold g.27: FnI-like domain [57602] (1 superfamily)
    disulfide-rich, all-beta
  4. 1243610Superfamily g.27.1: FnI-like domain [57603] (2 families) (S)
  5. 1243611Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
  6. 1243612Protein Fibronectin [57605] (1 species)
  7. 1243613Species Human (Homo sapiens) [TaxId:9606] [57606] (13 PDB entries)
  8. 1243658Domain d1qgba1: 1qgb A:17-60 [44952]
    1st and 2nd modules

Details for d1qgba1

PDB Entry: 1qgb (more details)

PDB Description: solution structure of the n-terminal f1 module pair from human fibronectin
PDB Compounds: (A:) protein (fibronectin)

SCOPe Domain Sequences for d1qgba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgba1 g.27.1.1 (A:17-60) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
skpgcydngkhyqinqqwertylgnalvctcyggsrgfnceskp

SCOPe Domain Coordinates for d1qgba1:

Click to download the PDB-style file with coordinates for d1qgba1.
(The format of our PDB-style files is described here.)

Timeline for d1qgba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qgba2