Lineage for d1e8ba3 (1e8b A:1-41)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 343712Fold g.27: Fibronectin type I module [57602] (1 superfamily)
    disulphide-rich, all-beta
  4. 343713Superfamily g.27.1: Fibronectin type I module [57603] (1 family) (S)
  5. 343714Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
  6. 343715Protein Fibronectin [57605] (1 species)
  7. 343716Species Human (Homo sapiens) [TaxId:9606] [57606] (6 PDB entries)
  8. 343723Domain d1e8ba3: 1e8b A:1-41 [44951]
    Other proteins in same PDB: d1e8ba1, d1e8ba2
    part of the gelatin-binding domain
    complexed with nag

Details for d1e8ba3

PDB Entry: 1e8b (more details)

PDB Description: solution structure of 6f11f22f2, a compact three-module fragment of the gelatin-binding domain of human fibronectin

SCOP Domain Sequences for d1e8ba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8ba3 g.27.1.1 (A:1-41) Fibronectin {Human (Homo sapiens)}
yghcvtdsgvvysvgmqwlktqgnkqmlctclgngvscqet

SCOP Domain Coordinates for d1e8ba3:

Click to download the PDB-style file with coordinates for d1e8ba3.
(The format of our PDB-style files is described here.)

Timeline for d1e8ba3: