Lineage for d1du3h2 (1du3 H:62-101)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 90012Fold g.24: TNF receptor-like [57585] (1 superfamily)
  4. 90013Superfamily g.24.1: TNF receptor-like [57586] (1 family) (S)
  5. 90014Family g.24.1.1: TNF receptor-like [57587] (3 proteins)
  6. 90019Protein Death receptor-5 (dr5) fragment [57590] (1 species)
  7. 90020Species Human (Homo sapiens) [TaxId:9606] [57591] (3 PDB entries)
  8. 90046Domain d1du3h2: 1du3 H:62-101 [44940]
    Other proteins in same PDB: d1du3d_, d1du3e_, d1du3f_, d1du3j_, d1du3k_, d1du3l_

Details for d1du3h2

PDB Entry: 1du3 (more details), 2.2 Å

PDB Description: crystal structure of trail-sdr5

SCOP Domain Sequences for d1du3h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1du3h2 g.24.1.1 (H:62-101) Death receptor-5 (dr5) fragment {Human (Homo sapiens)}
rctrcdsgevelspctttrntvcqceegtfreedspemcr

SCOP Domain Coordinates for d1du3h2:

Click to download the PDB-style file with coordinates for d1du3h2.
(The format of our PDB-style files is described here.)

Timeline for d1du3h2: