Lineage for d1du3b1 (1du3 B:21-61)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749631Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 749632Superfamily g.24.1: TNF receptor-like [57586] (2 families) (S)
  5. 749633Family g.24.1.1: TNF receptor-like [57587] (5 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 749642Protein Death receptor-5 (dr5) fragment [57590] (1 species)
  7. 749643Species Human (Homo sapiens) [TaxId:9606] [57591] (5 PDB entries)
  8. 749662Domain d1du3b1: 1du3 B:21-61 [44930]
    Other proteins in same PDB: d1du3d_, d1du3e_, d1du3f_, d1du3j_, d1du3k_, d1du3l_

Details for d1du3b1

PDB Entry: 1du3 (more details), 2.2 Å

PDB Description: crystal structure of trail-sdr5
PDB Compounds: (B:) death receptor 5

SCOP Domain Sequences for d1du3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1du3b1 g.24.1.1 (B:21-61) Death receptor-5 (dr5) fragment {Human (Homo sapiens) [TaxId: 9606]}
sspseglcppghhisedgrdcisckygqdysthwndllfcl

SCOP Domain Coordinates for d1du3b1:

Click to download the PDB-style file with coordinates for d1du3b1.
(The format of our PDB-style files is described here.)

Timeline for d1du3b1: