Lineage for d1d4va1 (1d4v A:69-114)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2585872Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 2585873Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 2585874Family g.24.1.1: TNF receptor-like [57587] (6 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 2585883Protein Death receptor-5 (dr5) fragment [57590] (1 species)
  7. 2585884Species Human (Homo sapiens) [TaxId:9606] [57591] (5 PDB entries)
  8. 2585885Domain d1d4va1: 1d4v A:69-114 [44915]
    Other proteins in same PDB: d1d4vb_

Details for d1d4va1

PDB Entry: 1d4v (more details), 2.2 Å

PDB Description: crystal structure of trail-dr5 complex
PDB Compounds: (A:) death receptor 5

SCOPe Domain Sequences for d1d4va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4va1 g.24.1.1 (A:69-114) Death receptor-5 (dr5) fragment {Human (Homo sapiens) [TaxId: 9606]}
pqqkrsspseglcppghhisedgrdcisckygqdysthwndllfcl

SCOPe Domain Coordinates for d1d4va1:

Click to download the PDB-style file with coordinates for d1d4va1.
(The format of our PDB-style files is described here.)

Timeline for d1d4va1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1d4vb_