![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
![]() | Superfamily g.24.1: TNF receptor-like [57586] (3 families) ![]() |
![]() | Family g.24.1.1: TNF receptor-like [57587] (13 proteins) Pfam PF00020; TNFR/NGFR cysteine-rich region |
![]() | Protein Death receptor-5 (dr5) fragment, N- and C-terminal domain [419060] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [419551] (5 PDB entries) |
![]() | Domain d1d4va1: 1d4v A:69-114 [44915] Other proteins in same PDB: d1d4va2, d1d4vb_ fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1d4v (more details), 2.2 Å
SCOPe Domain Sequences for d1d4va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d4va1 g.24.1.1 (A:69-114) Death receptor-5 (dr5) fragment, N- and C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} pqqkrsspseglcppghhisedgrdcisckygqdysthwndllfcl
Timeline for d1d4va1: