Lineage for d1ncfb1 (1ncf B:14-71)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1064701Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 1064702Superfamily g.24.1: TNF receptor-like [57586] (2 families) (S)
  5. 1064703Family g.24.1.1: TNF receptor-like [57587] (5 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 1064767Protein Tumor necrosis factor (TNF) receptor [57588] (1 species)
  7. 1064768Species Human (Homo sapiens) [TaxId:9606] [57589] (4 PDB entries)
  8. 1064778Domain d1ncfb1: 1ncf B:14-71 [44909]

Details for d1ncfb1

PDB Entry: 1ncf (more details), 2.25 Å

PDB Description: a new paradigm for tumor necrosis factor signalling
PDB Compounds: (B:) tumor necrosis factor receptor

SCOPe Domain Sequences for d1ncfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncfb1 g.24.1.1 (B:14-71) Tumor necrosis factor (TNF) receptor {Human (Homo sapiens) [TaxId: 9606]}
vcpqgkyihpqnnsicctkchkgtylyndcpgpgqdtdcrecesgsftasenhlrhcl

SCOPe Domain Coordinates for d1ncfb1:

Click to download the PDB-style file with coordinates for d1ncfb1.
(The format of our PDB-style files is described here.)

Timeline for d1ncfb1: