Class g: Small proteins [56992] (100 folds) |
Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
Superfamily g.24.1: TNF receptor-like [57586] (3 families) |
Family g.24.1.1: TNF receptor-like [57587] (13 proteins) Pfam PF00020; TNFR/NGFR cysteine-rich region |
Domain d1extb3: 1ext B:116-168 [44905] Other proteins in same PDB: d1exta1, d1exta2, d1extb1, d1extb2, d1extb4 complexed with mg, so4 has additional secondary structure elements or disulfide bonds beyond those in the common domain |
PDB Entry: 1ext (more details), 1.85 Å
SCOPe Domain Sequences for d1extb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1extb3 g.24.1.1 (B:116-168) Tumor necrosis factor (TNF) receptor, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} ncslclngtvhlscqekqntvctchagfflrenecvscsnckkslectklclp
Timeline for d1extb3: