SCOP 1.57: Domain d1extb2: 1ext B:72-115

Lineage for d1extb2 (1ext B:72-115)

1. Root: SCOP 1.57

2. Class g: Small proteins [56992] (56 folds)

3. Fold g.24: TNF receptor-like [57585] (1 superfamily)

4. Superfamily g.24.1: TNF receptor-like [57586] (1 family)

5. Family g.24.1.1: TNF receptor-like [57587] (3 proteins)

6. Protein Tumor necrosis factor (TNF) receptor [57588] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57589] (3 PDB entries)

8. Domain d1extb2: 1ext B:72-115 [44904]

Details for d1extb2

PDB Entry: 1ext, 1.85 Å

PDB Description: extracellular domain of the 55kda tumor necrosis factor receptor. crystallized at ph3.7 in p 21 21 21.

SCOP Domain Sequences for d1extb2:

Sequence; same for both SEQRES and ATOM records:

>d1extb2 g.24.1.1 (B:72-115) Tumor necrosis factor (TNF) receptor {Human (Homo sapiens)}
scskcrkemgqveissctvdrdtvcgcrknqyrhywsenlfqcf

Timeline for d1extb2:

• d1extb2 first appeared (with stable ids) in SCOP 1.55
  
• d1extb2 appears in SCOP 1.59
  
• d1extb2 appears in the current release, SCOPe 2.08