Lineage for d1exta3 (1ext A:116-172)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034651Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 3034652Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 3034653Family g.24.1.1: TNF receptor-like [57587] (13 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. Protein Tumor necrosis factor (TNF) receptor, C-terminal domain [419067] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [419558] (4 PDB entries)
  8. 3034728Domain d1exta3: 1ext A:116-172 [44902]
    Other proteins in same PDB: d1exta1, d1exta2, d1extb1, d1extb2, d1extb4
    complexed with mg, so4
    has additional secondary structure elements or disulfide bonds beyond those in the common domain

Details for d1exta3

PDB Entry: 1ext (more details), 1.85 Å

PDB Description: extracellular domain of the 55kda tumor necrosis factor receptor. crystallized at ph3.7 in p 21 21 21.
PDB Compounds: (A:) tumor necrosis factor receptor

SCOPe Domain Sequences for d1exta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exta3 g.24.1.1 (A:116-172) Tumor necrosis factor (TNF) receptor, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ncslclngtvhlscqekqntvctchagfflrenecvscsnckkslectklclpqien

SCOPe Domain Coordinates for d1exta3:

Click to download the PDB-style file with coordinates for d1exta3.
(The format of our PDB-style files is described here.)

Timeline for d1exta3: