Lineage for d1ccva_ (1ccv A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034610Fold g.22: Serine protease inhibitors [57566] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 3034611Superfamily g.22.1: Serine protease inhibitors [57567] (2 families) (S)
  5. 3034612Family g.22.1.1: ATI-like [57568] (5 proteins)
    automatically mapped to Pfam PF01826
  6. 3034626Protein Chymotrypsin inhibitor AMCI [57575] (1 species)
  7. 3034627Species Honeybee (Apis mellifera) [TaxId:7460] [57576] (1 PDB entry)
  8. 3034628Domain d1ccva_: 1ccv A: [44897]

Details for d1ccva_

PDB Entry: 1ccv (more details)

PDB Description: nmr solution structure of apis mellifera chymotrypsin inhibitor (amci).
PDB Compounds: (A:) chymotrypsin inhibitor

SCOPe Domain Sequences for d1ccva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ccva_ g.22.1.1 (A:) Chymotrypsin inhibitor AMCI {Honeybee (Apis mellifera) [TaxId: 7460]}
eecgpnevfntcgsacaptcaqpktrictmqcrigcqcqegflrngegacvlpenc

SCOPe Domain Coordinates for d1ccva_:

Click to download the PDB-style file with coordinates for d1ccva_.
(The format of our PDB-style files is described here.)

Timeline for d1ccva_: