Class g: Small proteins [56992] (100 folds) |
Fold g.22: Serine protease inhibitors [57566] (1 superfamily) disulfide-rich; nearly all-beta |
Superfamily g.22.1: Serine protease inhibitors [57567] (2 families) |
Family g.22.1.1: ATI-like [57568] (5 proteins) automatically mapped to Pfam PF01826 |
Protein Chymotrypsin inhibitor AMCI [57575] (1 species) |
Species Honeybee (Apis mellifera) [TaxId:7460] [57576] (1 PDB entry) |
Domain d1ccva_: 1ccv A: [44897] |
PDB Entry: 1ccv (more details)
SCOPe Domain Sequences for d1ccva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ccva_ g.22.1.1 (A:) Chymotrypsin inhibitor AMCI {Honeybee (Apis mellifera) [TaxId: 7460]} eecgpnevfntcgsacaptcaqpktrictmqcrigcqcqegflrngegacvlpenc
Timeline for d1ccva_: