Lineage for d1atda_ (1atd A:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.22: Serine protease inhibitors [57566] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. Superfamily g.22.1: Serine protease inhibitors [57567] (2 families) (S)
  5. Family g.22.1.1: ATI-like [57568] (5 proteins)
    automatically mapped to Pfam PF01826
  6. Protein Ascaris trypsin inhibitor, ATI [57569] (1 species)
  7. Species Pig roundworm (Ascaris suum) [TaxId:6253] [57570] (4 PDB entries)
  8. Domain d1atda_: 1atd A: [44892]

Details for d1atda_

PDB Entry: 1atd (more details)

PDB Description: high-resolution structure of ascaris trypsin inhibitor in solution: direct evidence for a ph induced conformational transition in the reactive site
PDB Compounds: (A:) ascaris trypsin inhibitor

SCOPe Domain Sequences for d1atda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1atda_ g.22.1.1 (A:) Ascaris trypsin inhibitor, ATI {Pig roundworm (Ascaris suum) [TaxId: 6253]}
eaekctkpneqwtkcggcegtcaqkivpctreckpprceciasagfvrdaqgncikfedc
pk

SCOPe Domain Coordinates for d1atda_ are not available.

Timeline for d1atda_: