Lineage for d1atea_ (1ate A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034610Fold g.22: Serine protease inhibitors [57566] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 3034611Superfamily g.22.1: Serine protease inhibitors [57567] (2 families) (S)
  5. 3034612Family g.22.1.1: ATI-like [57568] (5 proteins)
    automatically mapped to Pfam PF01826
  6. 3034620Protein Ascaris trypsin inhibitor, ATI [57569] (1 species)
  7. 3034621Species Pig roundworm (Ascaris suum) [TaxId:6253] [57570] (4 PDB entries)
  8. 3034624Domain d1atea_: 1ate A: [44891]

Details for d1atea_

PDB Entry: 1ate (more details)

PDB Description: high-resolution structure of ascaris trypsin inhibitor in solution: direct evidence for a ph induced conformational transition in the reactive site
PDB Compounds: (A:) ascaris trypsin inhibitor

SCOPe Domain Sequences for d1atea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1atea_ g.22.1.1 (A:) Ascaris trypsin inhibitor, ATI {Pig roundworm (Ascaris suum) [TaxId: 6253]}
eaekctkpneqwtkcggcegtcaqkivpctreckpprceciasagfvrdaqgncikfedc
pk

SCOPe Domain Coordinates for d1atea_:

Click to download the PDB-style file with coordinates for d1atea_.
(The format of our PDB-style files is described here.)

Timeline for d1atea_: