Lineage for d1mael_ (1mae L:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1964111Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1964112Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1964113Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 1964114Protein Methylamine dehydrogenase [57563] (2 species)
  7. 1964132Species Paracoccus versutus (Thiobacillus versutus) [TaxId:34007] [57565] (3 PDB entries)
  8. 1964135Domain d1mael_: 1mae L: [44889]
    Other proteins in same PDB: d1maeh_
    complexed with hdz

Details for d1mael_

PDB Entry: 1mae (more details), 2.8 Å

PDB Description: The Active Site Structure of Methylamine Dehydrogenase: Hydrazines Identify C6 as the Reactive Site of the Tryptophan Derived Quinone Cofactor
PDB Compounds: (L:) methylamine dehydrogenase (light subunit)

SCOPe Domain Sequences for d1mael_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mael_ g.21.1.1 (L:) Methylamine dehydrogenase {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]}
vdprakwqpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgka

SCOPe Domain Coordinates for d1mael_:

Click to download the PDB-style file with coordinates for d1mael_.
(The format of our PDB-style files is described here.)

Timeline for d1mael_: