SCOP 1.57: Domain d1mael_: 1mae L:

Lineage for d1mael_ (1mae L:)

1. Root: SCOP 1.57

2. Class g: Small proteins [56992] (56 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (1 family)

5. Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (1 protein)

6. Protein Methylamine dehydrogenase [57563] (2 species)

7. Species Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId:34007] [57565] (3 PDB entries)

8. Domain d1mael_: 1mae L: [44889]
   Other proteins in same PDB: d1maeh_

Details for d1mael_

PDB Entry: 1mae, 2.8 Å

PDB Description: The Active Site Structure of Methylamine Dehydrogenase: Hydrazines Identify C6 as the Reactive Site of the Tryptophan Derived Quinone Cofactor

SCOP Domain Sequences for d1mael_:

Sequence; same for both SEQRES and ATOM records:

>d1mael_ g.21.1.1 (L:) Methylamine dehydrogenase {Gram negative methylotrophic bacteria (Thiobacillus versutus)}
vdprakwqpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgka

Timeline for d1mael_:

• d1mael_ first appeared (with stable ids) in SCOP 1.55
  
• d1mael_ appears in SCOP 1.59
  
• d1mael_ appears in the current release, SCOPe 2.08