Lineage for d1mafl_ (1maf L:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41006Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
  4. 41007Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (1 family) (S)
  5. 41008Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (1 protein)
  6. 41009Protein Methylamine dehydrogenase [57563] (2 species)
  7. 41010Species Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId:34007] [57565] (3 PDB entries)
  8. 41012Domain d1mafl_: 1maf L: [44888]
    Other proteins in same PDB: d1mafh_

Details for d1mafl_

PDB Entry: 1maf (more details), 2.6 Å

PDB Description: The Active Site Structure of Methylamine Dehydrogenase: Hydrazines Identify C6 as the Reactive Site of the Tryptophan Derived Quinone Cofactor

SCOP Domain Sequences for d1mafl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mafl_ g.21.1.1 (L:) Methylamine dehydrogenase {Gram negative methylotrophic bacteria (Thiobacillus versutus)}
vdprakwqpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgka

SCOP Domain Coordinates for d1mafl_:

Click to download the PDB-style file with coordinates for d1mafl_.
(The format of our PDB-style files is described here.)

Timeline for d1mafl_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mafh_