Lineage for d1mafl_ (1maf L:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily) Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (1 family) 
Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (1 protein) Protein Methylamine dehydrogenase [57563] (2 species) 
Species Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId:34007] [57565] (3 PDB entries) 
Domain d1mafl_: 1maf L: [44888]
Other proteins in same PDB: d1mafh_
Details for d1mafl_
PDB Entry: 1maf (more details), 2.6 Å
PDB Description: The Active Site Structure of Methylamine Dehydrogenase: Hydrazines Identify C6 as the Reactive Site of the Tryptophan Derived Quinone Cofactor
SCOP Domain Sequences for d1mafl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mafl_ g.21.1.1 (L:) Methylamine dehydrogenase {Gram negative methylotrophic bacteria (Thiobacillus versutus)}
vdprakwqpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgka
SCOP Domain Coordinates for d1mafl_:
Click to download the PDB-style file with coordinates for d1mafl_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mafl_:
- d1mafl_ appears in SCOP 1.57
- d1mafl_ appears in the current release, SCOPe 2.08
View in 3D
