SCOPe 2.02: Domain d2madl_: 2mad L:

Lineage for d2madl_ (2mad L:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families)

5. Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)

6. Protein Methylamine dehydrogenase [57563] (2 species)

7. Species Paracoccus versutus (Thiobacillus versutus) [TaxId:34007] [57565] (3 PDB entries)

8. Domain d2madl_: 2mad L: [44887]
   Other proteins in same PDB: d2madh_

Details for d2madl_

PDB Entry: 2mad, 2.25 Å

PDB Description: the active site structure of methylamine dehydrogenase: hydrazines identify c6 as the reactive site of the tryptophan derived quinone cofactor

PDB Compounds: (L:) methylamine dehydrogenase (light subunit)

SCOPe Domain Sequences for d2madl_:

Sequence; same for both SEQRES and ATOM records:

>d2madl_ g.21.1.1 (L:) Methylamine dehydrogenase {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]}
vdprakwqpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgka

Timeline for d2madl_:

• d2madl_ first appeared (with stable ids) in SCOP 1.55
  
• d2madl_ appears in SCOPe 2.01
  
• d2madl_ appears in SCOPe 2.03
  
• d2madl_ appears in the current release, SCOPe 2.08