Lineage for d2madl_ (2mad L:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034451Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 3034452Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 3034453Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 3034454Protein Methylamine dehydrogenase [57563] (2 species)
  7. 3034506Species Paracoccus versutus (Thiobacillus versutus) [TaxId:34007] [57565] (3 PDB entries)
  8. 3034507Domain d2madl_: 2mad L: [44887]
    Other proteins in same PDB: d2madh_

Details for d2madl_

PDB Entry: 2mad (more details), 2.25 Å

PDB Description: the active site structure of methylamine dehydrogenase: hydrazines identify c6 as the reactive site of the tryptophan derived quinone cofactor
PDB Compounds: (L:) methylamine dehydrogenase (light subunit)

SCOPe Domain Sequences for d2madl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2madl_ g.21.1.1 (L:) Methylamine dehydrogenase {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]}
vdprakwqpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgka

SCOPe Domain Coordinates for d2madl_:

Click to download the PDB-style file with coordinates for d2madl_.
(The format of our PDB-style files is described here.)

Timeline for d2madl_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2madh_