Lineage for d1mdam_ (1mda M:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89969Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
  4. 89970Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (1 family) (S)
  5. 89971Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (1 protein)
  6. 89972Protein Methylamine dehydrogenase [57563] (2 species)
  7. 89977Species Paracoccus denitrificans [TaxId:266] [57564] (3 PDB entries)
  8. 89982Domain d1mdam_: 1mda M: [44886]
    Other proteins in same PDB: d1mdaa_, d1mdab_, d1mdah_, d1mdaj_

Details for d1mdam_

PDB Entry: 1mda (more details), 2.5 Å

PDB Description: crystal structure of an electron-transfer complex between methylamine dehydrogenase and amicyanin

SCOP Domain Sequences for d1mdam_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdam_ g.21.1.1 (M:) Methylamine dehydrogenase {Paracoccus denitrificans}
vdprakwqpqdndiqacdywrhcsiagnicdcsagsltscppgtlvasgswvgscynppd
pnkyitayrdccgynvsgrcaclntegelpvynkdandiiwcfggedgmtyhcsispvsg
a

SCOP Domain Coordinates for d1mdam_:

Click to download the PDB-style file with coordinates for d1mdam_.
(The format of our PDB-style files is described here.)

Timeline for d1mdam_: