Lineage for d1mdal_ (1mda L:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639172Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 2639173Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 2639174Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 2639175Protein Methylamine dehydrogenase [57563] (2 species)
  7. 2639176Species Paracoccus denitrificans [TaxId:266] [57564] (24 PDB entries)
  8. 2639225Domain d1mdal_: 1mda L: [44885]
    Other proteins in same PDB: d1mdaa_, d1mdab_, d1mdah_, d1mdaj_
    complexed with cu

Details for d1mdal_

PDB Entry: 1mda (more details), 2.5 Å

PDB Description: crystal structure of an electron-transfer complex between methylamine dehydrogenase and amicyanin
PDB Compounds: (L:) methylamine dehydrogenase (light subunit)

SCOPe Domain Sequences for d1mdal_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdal_ g.21.1.1 (L:) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
vdprakwqpqdndiqacdywrhcsiagnicdcsagsltscppgtlvasgswvgscynppd
pnkyitayrdccgynvsgrcaclntegelpvynkdandiiwcfggedgmtyhcsispvsg
a

SCOPe Domain Coordinates for d1mdal_:

Click to download the PDB-style file with coordinates for d1mdal_.
(The format of our PDB-style files is described here.)

Timeline for d1mdal_: