SCOP 1.75: Domain d1mdal_: 1mda L:

Lineage for d1mdal_ (1mda L:)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (1 family)

5. Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (1 protein)

6. Protein Methylamine dehydrogenase [57563] (2 species)

7. Species Paracoccus denitrificans [TaxId:266] [57564] (10 PDB entries)

8. Domain d1mdal_: 1mda L: [44885]
   Other proteins in same PDB: d1mdaa_, d1mdab_, d1mdah_, d1mdaj_

Details for d1mdal_

PDB Entry: 1mda, 2.5 Å

PDB Description: crystal structure of an electron-transfer complex between methylamine dehydrogenase and amicyanin

PDB Compounds: (L:) methylamine dehydrogenase (light subunit)

SCOP Domain Sequences for d1mdal_:

Sequence; same for both SEQRES and ATOM records:

>d1mdal_ g.21.1.1 (L:) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
vdprakwqpqdndiqacdywrhcsiagnicdcsagsltscppgtlvasgswvgscynppd
pnkyitayrdccgynvsgrcaclntegelpvynkdandiiwcfggedgmtyhcsispvsg
a

Timeline for d1mdal_:

• d1mdal_ first appeared (with stable ids) in SCOP 1.55
  
• d1mdal_ appears in SCOP 1.73
  
• d1mdal_ appears in SCOPe 2.01
  
• d1mdal_ appears in the current release, SCOPe 2.08