Lineage for d1mdal_ (1mda L:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144332Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
  4. 144333Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (1 family) (S)
  5. 144334Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (1 protein)
  6. 144335Protein Methylamine dehydrogenase [57563] (2 species)
  7. 144340Species Paracoccus denitrificans [TaxId:266] [57564] (3 PDB entries)
  8. 144344Domain d1mdal_: 1mda L: [44885]
    Other proteins in same PDB: d1mdaa_, d1mdab_, d1mdah_, d1mdaj_

Details for d1mdal_

PDB Entry: 1mda (more details), 2.5 Å

PDB Description: crystal structure of an electron-transfer complex between methylamine dehydrogenase and amicyanin

SCOP Domain Sequences for d1mdal_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdal_ g.21.1.1 (L:) Methylamine dehydrogenase {Paracoccus denitrificans}
vdprakwqpqdndiqacdywrhcsiagnicdcsagsltscppgtlvasgswvgscynppd
pnkyitayrdccgynvsgrcaclntegelpvynkdandiiwcfggedgmtyhcsispvsg
a

SCOP Domain Coordinates for d1mdal_:

Click to download the PDB-style file with coordinates for d1mdal_.
(The format of our PDB-style files is described here.)

Timeline for d1mdal_: