Lineage for d2mtal_ (2mta L:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily) Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (1 family) 
Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (1 protein) Protein Methylamine dehydrogenase [57563] (2 species) Species Paracoccus denitrificans [TaxId:266] [57564] (3 PDB entries) 
Domain d2mtal_: 2mta L: [44884]
Other proteins in same PDB: d2mtaa_, d2mtac_, d2mtah_
Details for d2mtal_
PDB Entry: 2mta (more details), 2.4 Å
PDB Description: crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
SCOP Domain Sequences for d2mtal_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mtal_ g.21.1.1 (L:) Methylamine dehydrogenase {Paracoccus denitrificans}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas
SCOP Domain Coordinates for d2mtal_:
Click to download the PDB-style file with coordinates for d2mtal_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2mtal_:
- d2mtal_ appears in SCOP 1.57
- d2mtal_ appears in the current release, SCOPe 2.08
View in 3D
