Lineage for d2bbkl_ (2bbk L:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144332Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
  4. 144333Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (1 family) (S)
  5. 144334Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (1 protein)
  6. 144335Protein Methylamine dehydrogenase [57563] (2 species)
  7. 144340Species Paracoccus denitrificans [TaxId:266] [57564] (3 PDB entries)
  8. 144341Domain d2bbkl_: 2bbk L: [44882]
    Other proteins in same PDB: d2bbkh_, d2bbkj_

Details for d2bbkl_

PDB Entry: 2bbk (more details), 1.75 Å

PDB Description: crystal structure of the quinoprotein methylamine dehydrogenase from paracoccus denitrificans at 1.75 angstroms

SCOP Domain Sequences for d2bbkl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bbkl_ g.21.1.1 (L:) Methylamine dehydrogenase {Paracoccus denitrificans}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOP Domain Coordinates for d2bbkl_:

Click to download the PDB-style file with coordinates for d2bbkl_.
(The format of our PDB-style files is described here.)

Timeline for d2bbkl_: