Lineage for d1cklf2 (1ckl F:63-126)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1462047Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 1462048Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 1462049Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins)
    Pfam PF00084
  6. 1462066Protein CD46 (membrane cofactor protein, MCP) [57541] (1 species)
  7. 1462067Species Human (Homo sapiens) [TaxId:9606] [57542] (2 PDB entries)
  8. 1462083Domain d1cklf2: 1ckl F:63-126 [44862]
    N-terminal two domains
    complexed with ca, cl

Details for d1cklf2

PDB Entry: 1ckl (more details), 3.1 Å

PDB Description: n-terminal two domains of human cd46 (membrane cofactor protein, mcp)
PDB Compounds: (F:) protein (cd46)

SCOPe Domain Sequences for d1cklf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cklf2 g.18.1.1 (F:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]}
etcpyirdplngqavpangtyefgyqmhficnegyyligeeilycelkgsvaiwsgkppi
cekv

SCOPe Domain Coordinates for d1cklf2:

Click to download the PDB-style file with coordinates for d1cklf2.
(The format of our PDB-style files is described here.)

Timeline for d1cklf2: