Lineage for d1cklf1 (1ckl F:1-62)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034014Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 3034015Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 3034016Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 3034056Protein CD46 (membrane cofactor protein, MCP) [57541] (1 species)
  7. 3034057Species Human (Homo sapiens) [TaxId:9606] [57542] (2 PDB entries)
  8. 3034072Domain d1cklf1: 1ckl F:1-62 [44861]
    N-terminal two domains
    complexed with ca, cl

Details for d1cklf1

PDB Entry: 1ckl (more details), 3.1 Å

PDB Description: n-terminal two domains of human cd46 (membrane cofactor protein, mcp)
PDB Compounds: (F:) protein (cd46)

SCOPe Domain Sequences for d1cklf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cklf1 g.18.1.1 (F:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]}
ceepptfeameligkpkpyyeigervdykckkgyfyipplathticdrnhtwlpvsddac
yr

SCOPe Domain Coordinates for d1cklf1:

Click to download the PDB-style file with coordinates for d1cklf1.
(The format of our PDB-style files is described here.)

Timeline for d1cklf1: