Lineage for d1ckld2 (1ckl D:63-126)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40917Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
  4. 40918Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 40919Family g.18.1.1: Complement control module/SCR domain [57536] (4 proteins)
  6. 40934Protein CD46 (membrane cofactor protein, MCP) [57541] (1 species)
  7. 40935Species Human (Homo sapiens) [TaxId:9606] [57542] (1 PDB entry)
  8. 40943Domain d1ckld2: 1ckl D:63-126 [44858]

Details for d1ckld2

PDB Entry: 1ckl (more details), 3.1 Å

PDB Description: n-terminal two domains of human cd46 (membrane cofactor protein, mcp)

SCOP Domain Sequences for d1ckld2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ckld2 g.18.1.1 (D:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens)}
etcpyirdplngqavpangtyefgyqmhficnegyyligeeilycelkgsvaiwsgkppi
cekv

SCOP Domain Coordinates for d1ckld2:

Click to download the PDB-style file with coordinates for d1ckld2.
(The format of our PDB-style files is described here.)

Timeline for d1ckld2: