SCOPe 2.03: Domain d1cklb2: 1ckl B:63-126

Lineage for d1cklb2 (1ckl B:63-126)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins)
   Pfam PF00084

6. Protein CD46 (membrane cofactor protein, MCP) [57541] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57542] (2 PDB entries)

8. Domain d1cklb2: 1ckl B:63-126 [44854]
   N-terminal two domains
   complexed with ca, cl

Details for d1cklb2

PDB Entry: 1ckl, 3.1 Å

PDB Description: n-terminal two domains of human cd46 (membrane cofactor protein, mcp)

PDB Compounds: (B:) protein (cd46)

SCOPe Domain Sequences for d1cklb2:

Sequence; same for both SEQRES and ATOM records:

>d1cklb2 g.18.1.1 (B:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]}
etcpyirdplngqavpangtyefgyqmhficnegyyligeeilycelkgsvaiwsgkppi
cekv

Timeline for d1cklb2:

• d1cklb2 first appeared (with stable ids) in SCOP 1.55
  
• d1cklb2 appears in SCOPe 2.02
  
• d1cklb2 appears in SCOPe 2.04
  
• d1cklb2 appears in the current release, SCOPe 2.08