Class g: Small proteins [56992] (90 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) |
Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins) Pfam PF00084 |
Protein CD46 (membrane cofactor protein, MCP) [57541] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57542] (2 PDB entries) |
Domain d1cklb1: 1ckl B:1-62 [44853] N-terminal two domains complexed with ca, cl |
PDB Entry: 1ckl (more details), 3.1 Å
SCOPe Domain Sequences for d1cklb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cklb1 g.18.1.1 (B:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} ceepptfeameligkpkpyyeigervdykckkgyfyipplathticdrnhtwlpvsddac yr
Timeline for d1cklb1: