Lineage for d1e5ga2 (1e5g A:69-126)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034014Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 3034015Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 3034016Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 3034085Protein Complement control protein [57539] (1 species)
  7. 3034086Species Vaccinia virus [TaxId:10245] [57540] (8 PDB entries)
    Uniprot P10998
    a complement protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans
  8. 3034124Domain d1e5ga2: 1e5g A:69-126 [44844]
    central cp module pair

Details for d1e5ga2

PDB Entry: 1e5g (more details)

PDB Description: Solution structure of central CP module pair of a pox virus complement inhibitor
PDB Compounds: (A:) complement control protein c3

SCOPe Domain Sequences for d1e5ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5ga2 g.18.1.1 (A:69-126) Complement control protein {Vaccinia virus [TaxId: 10245]}
vkcqsppsisngrhngyedfytdgsvvtyscnsgyslignsgvlcsggewsdpptcqi

SCOPe Domain Coordinates for d1e5ga2:

Click to download the PDB-style file with coordinates for d1e5ga2.
(The format of our PDB-style files is described here.)

Timeline for d1e5ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e5ga1