Class g: Small proteins [56992] (100 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) |
Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
Protein Complement control protein [57539] (1 species) |
Species Vaccinia virus [TaxId:10245] [57540] (8 PDB entries) Uniprot P10998 a complement protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans |
Domain d1e5ga2: 1e5g A:69-126 [44844] central cp module pair |
PDB Entry: 1e5g (more details)
SCOPe Domain Sequences for d1e5ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e5ga2 g.18.1.1 (A:69-126) Complement control protein {Vaccinia virus [TaxId: 10245]} vkcqsppsisngrhngyedfytdgsvvtyscnsgyslignsgvlcsggewsdpptcqi
Timeline for d1e5ga2: