![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
![]() | Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) ![]() |
![]() | Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
![]() | Protein Complement control protein [57539] (1 species) |
![]() | Species Vaccinia virus [TaxId:10245] [57540] (8 PDB entries) Uniprot P10998 a complement protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans |
![]() | Domain d1e5ga1: 1e5g A:7-68 [44843] central cp module pair |
PDB Entry: 1e5g (more details)
SCOPe Domain Sequences for d1e5ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e5ga1 g.18.1.1 (A:7-68) Complement control protein {Vaccinia virus [TaxId: 10245]} rrcpsprdidngqldiggvdfgssityscnsgyhligesksycelgstgsmvwnpeapic es
Timeline for d1e5ga1: