SCOPe 2.08: Domain d1e5ga1: 1e5g A:7-68

Lineage for d1e5ga1 (1e5g A:7-68)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Complement control protein [57539] (1 species)

7. Species Vaccinia virus [TaxId:10245] [57540] (8 PDB entries)
   Uniprot P10998
   a complement protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans

8. Domain d1e5ga1: 1e5g A:7-68 [44843]
   central cp module pair

Details for d1e5ga1

PDB Entry: 1e5g

PDB Description: Solution structure of central CP module pair of a pox virus complement inhibitor

PDB Compounds: (A:) complement control protein c3

SCOPe Domain Sequences for d1e5ga1:

Sequence; same for both SEQRES and ATOM records:

>d1e5ga1 g.18.1.1 (A:7-68) Complement control protein {Vaccinia virus [TaxId: 10245]}
rrcpsprdidngqldiggvdfgssityscnsgyhligesksycelgstgsmvwnpeapic
es

Timeline for d1e5ga1:

• d1e5ga1 first appeared (with stable ids) in SCOP 1.55
  
• d1e5ga1 appears in SCOPe 2.07