SCOP 1.69: Domain d1g44c2: 1g44 C:65-125

Lineage for d1g44c2 (1g44 C:65-125)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (10 proteins)

6. Protein Complement control protein [57539] (1 species)

7. Species Vaccinia virus [TaxId:10245] [57540] (7 PDB entries)
   a complement protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans

8. Domain d1g44c2: 1g44 C:65-125 [44840]

Details for d1g44c2

PDB Entry: 1g44, 2.6 Å

PDB Description: crystal structure of a complement control protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans

SCOP Domain Sequences for d1g44c2:

Sequence, based on SEQRES records:

>d1g44c2 g.18.1.1 (C:65-125) Complement control protein {Vaccinia virus}
rrcpsprdidngqldiggvdfgssityscnsgyhligesksycelgstgsmvwnpeapic
e

Sequence, based on observed residues (ATOM records):

>d1g44c2 g.18.1.1 (C:65-125) Complement control protein {Vaccinia virus}
rrcpsprddgqldiggvdfgssityscnsgyhligesksycelgtgsmvwnpeapice

Timeline for d1g44c2:

• d1g44c2 first appeared (with stable ids) in SCOP 1.55
  
• d1g44c2 appears in SCOP 1.67
  
• d1g44c2 appears in SCOP 1.71
  
• d1g44c2 appears in the current release, SCOPe 2.08