Lineage for d1g44a3 (1g44 A:127-184)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1963726Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 1963727Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 1963728Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 1963777Protein Complement control protein [57539] (1 species)
  7. 1963778Species Vaccinia virus [TaxId:10245] [57540] (8 PDB entries)
    Uniprot P10998
    a complement protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans
  8. 1963805Domain d1g44a3: 1g44 A:127-184 [44833]

Details for d1g44a3

PDB Entry: 1g44 (more details), 2.6 Å

PDB Description: crystal structure of a complement control protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans
PDB Compounds: (A:) complement control protein

SCOPe Domain Sequences for d1g44a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g44a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]}
vkcqsppsisngrhngyedfytdgsvvtyscnsgyslignsgvlcsggewsdpptcqi

SCOPe Domain Coordinates for d1g44a3:

Click to download the PDB-style file with coordinates for d1g44a3.
(The format of our PDB-style files is described here.)

Timeline for d1g44a3: