| Class g: Small proteins [56992] (75 folds) |
| Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) ![]() |
| Family g.18.1.1: Complement control module/SCR domain [57536] (10 proteins) |
| Protein Complement control protein [57539] (1 species) |
| Species Vaccinia virus [TaxId:10245] [57540] (7 PDB entries) a complement protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans |
| Domain d1g44a3: 1g44 A:127-184 [44833] |
PDB Entry: 1g44 (more details), 2.6 Å
SCOP Domain Sequences for d1g44a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g44a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus}
vkcqsppsisngrhngyedfytdgsvvtyscnsgyslignsgvlcsggewsdpptcqi
Timeline for d1g44a3: