SCOP 1.71: Domain d1g40b1: 1g40 B:1-64

Lineage for d1g40b1 (1g40 B:1-64)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (11 proteins)
   Pfam 00084

6. Protein Complement control protein [57539] (1 species)

7. Species Vaccinia virus [TaxId:10245] [57540] (7 PDB entries)
   a complement protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans

8. Domain d1g40b1: 1g40 B:1-64 [44827]

Details for d1g40b1

PDB Entry: 1g40, 2.2 Å

PDB Description: crystal structure of a complement protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans

SCOP Domain Sequences for d1g40b1:

Sequence; same for both SEQRES and ATOM records:

>d1g40b1 g.18.1.1 (B:1-64) Complement control protein {Vaccinia virus}
cctipsrpinmkfknsvetdananynigdtieylclpgyrkqkmgpiyakctgtgwtlfn
qcik

Timeline for d1g40b1:

• d1g40b1 first appeared (with stable ids) in SCOP 1.55
  
• d1g40b1 appears in SCOP 1.69
  
• d1g40b1 appears in SCOP 1.73
  
• d1g40b1 appears in the current release, SCOPe 2.08