Lineage for d1g40b1 (1g40 B:1-64)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 523102Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 523103Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 523104Family g.18.1.1: Complement control module/SCR domain [57536] (10 proteins)
  6. 523144Protein Complement control protein [57539] (1 species)
  7. 523145Species Vaccinia virus [TaxId:10245] [57540] (7 PDB entries)
    a complement protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans
  8. 523150Domain d1g40b1: 1g40 B:1-64 [44827]

Details for d1g40b1

PDB Entry: 1g40 (more details), 2.2 Å

PDB Description: crystal structure of a complement protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans

SCOP Domain Sequences for d1g40b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g40b1 g.18.1.1 (B:1-64) Complement control protein {Vaccinia virus}
cctipsrpinmkfknsvetdananynigdtieylclpgyrkqkmgpiyakctgtgwtlfn
qcik

SCOP Domain Coordinates for d1g40b1:

Click to download the PDB-style file with coordinates for d1g40b1.
(The format of our PDB-style files is described here.)

Timeline for d1g40b1: