Lineage for d1hfha1 (1hfh A:1-63)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749292Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 749293Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 749294Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins)
    Pfam PF00084
  6. 749495Protein Factor H, 15th and 16th modules [57537] (1 species)
  7. 749496Species Human (Homo sapiens) [TaxId:9606] [57538] (3 PDB entries)
  8. 749499Domain d1hfha1: 1hfh A:1-63 [44821]

Details for d1hfha1

PDB Entry: 1hfh (more details)

PDB Description: solution structure of a pair of complement modules by nuclear magnetic resonance
PDB Compounds: (A:) factor h, 15th and 16th c-module pair

SCOP Domain Sequences for d1hfha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfha1 g.18.1.1 (A:1-63) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]}
ekipcsqppqiehgtinssrssqesyahgtklsytceggfriseenettcymgkwssppq
ceg

SCOP Domain Coordinates for d1hfha1:

Click to download the PDB-style file with coordinates for d1hfha1.
(The format of our PDB-style files is described here.)

Timeline for d1hfha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hfha2