SCOP 1.73: Domain d1hfha1: 1hfh A:1-63

Lineage for d1hfha1 (1hfh A:1-63)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins)
   Pfam PF00084

6. Protein Factor H, 15th and 16th modules [57537] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57538] (3 PDB entries)

8. Domain d1hfha1: 1hfh A:1-63 [44821]

Details for d1hfha1

PDB Entry: 1hfh

PDB Description: solution structure of a pair of complement modules by nuclear magnetic resonance

PDB Compounds: (A:) factor h, 15th and 16th c-module pair

SCOP Domain Sequences for d1hfha1:

Sequence; same for both SEQRES and ATOM records:

>d1hfha1 g.18.1.1 (A:1-63) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]}
ekipcsqppqiehgtinssrssqesyahgtklsytceggfriseenettcymgkwssppq
ceg

Timeline for d1hfha1:

• d1hfha1 first appeared (with stable ids) in SCOP 1.55, called d1hfh_1
  
• d1hfha1 was called d1hfh_1 in SCOP 1.71
  
• d1hfha1 appears in SCOP 1.75
  
• d1hfha1 appears in the current release, SCOPe 2.08