SCOP 1.73: Domain d1hcca_: 1hcc A:

Lineage for d1hcca_ (1hcc A:)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins)
   Pfam PF00084

6. Protein Factor H, 15th and 16th modules [57537] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57538] (3 PDB entries)

8. Domain d1hcca_: 1hcc A: [44820]
   16th module only

Details for d1hcca_

PDB Entry: 1hcc

PDB Description: three-dimensional structure of a complement control protein module in solution

PDB Compounds: (A:) 16th complement control protein

SCOP Domain Sequences for d1hcca_:

Sequence; same for both SEQRES and ATOM records:

>d1hcca_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]}
eglpcksppeishgvvahmsdsyqygeevtykcfegfgidgpaiakclgekwshppsci

Timeline for d1hcca_:

• d1hcca_ first appeared (with stable ids) in SCOP 1.55, called d1hcc__
  
• d1hcca_ was called d1hcc__ in SCOP 1.71
  
• d1hcca_ appears in SCOP 1.75
  
• d1hcca_ appears in the current release, SCOPe 2.08